| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
| Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
| Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
| Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries) Coagulation factor XIII, |
| Domain d1ggyb2: 1ggy B:516-627 [22185] Other proteins in same PDB: d1ggya1, d1ggya4, d1ggyb1, d1ggyb4 complexed with yb |
PDB Entry: 1ggy (more details), 2.5 Å
SCOPe Domain Sequences for d1ggyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggyb2 b.1.5.1 (B:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
Timeline for d1ggyb2:
View in 3DDomains from other chains: (mouse over for more information) d1ggya1, d1ggya2, d1ggya3, d1ggya4 |