SCOPe 2.05: Domain d4gcya_: 4gcy A:

Lineage for d4gcya_ (4gcy A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein automated matches [190798] (8 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189128] (5 PDB entries)

8. Domain d4gcya_: 4gcy A: [221846]
   automated match to d1sixa_
   complexed with dup, gol, mg, trs; mutant

Details for d4gcya_

PDB Entry: 4gcy, 1.5 Å

PDB Description: Structure of Mycobacterium tuberculosis dUTPase H21W mutant

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d4gcya_:

Sequence; same for both SEQRES and ATOM records:

>d4gcya_ b.85.4.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sglvprgshmsttlaivrldpglplpsrawdgdagvdlysaedvelapgrralvrtgvav
avpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdri
aqllvqrvelvelvevssfdeaglastsrgdgghgssgghasl

Timeline for d4gcya_:

• d4gcya_ first appeared in SCOPe 2.03
  
• d4gcya_ appears in SCOPe 2.04
  
• d4gcya_ is called d4gcya1 in SCOPe 2.06
  
• d4gcya_ appears in the current release, SCOPe 2.08, called d4gcya1