SCOPe 2.07: Domain d4gcoa_: 4gco A:

Lineage for d4gcoa_ (4gco A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (10 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [226441] (1 PDB entry)

8. Domain d4gcoa_: 4gco A: [221840]
   automated match to d1elwb_

Details for d4gcoa_

PDB Entry: 4gco, 1.6 Å

PDB Description: central domain of stress-induced protein-1 (sti-1) from c.elegans

PDB Compounds: (A:) Protein STI-1

SCOPe Domain Sequences for d4gcoa_:

Sequence; same for both SEQRES and ATOM records:

>d4gcoa_ a.118.8.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
yinpelaqeeknkgneyfkkgdyptamrhyneavkrdpenailysnraacltklmefqra
lddcdtcirldskfikgyirkaaclvamrewskaqrayedalqvdpsneearegvrnclr

Timeline for d4gcoa_:

• d4gcoa_ first appeared in SCOPe 2.03
  
• d4gcoa_ appears in SCOPe 2.06
  
• d4gcoa_ appears in the current release, SCOPe 2.08