| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
| Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
| Protein automated matches [191037] (12 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [226441] (1 PDB entry) |
| Domain d4gcoa_: 4gco A: [221840] automated match to d1elwb_ |
PDB Entry: 4gco (more details), 1.6 Å
SCOPe Domain Sequences for d4gcoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gcoa_ a.118.8.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
yinpelaqeeknkgneyfkkgdyptamrhyneavkrdpenailysnraacltklmefqra
lddcdtcirldskfikgyirkaaclvamrewskaqrayedalqvdpsneearegvrnclr
Timeline for d4gcoa_: