Lineage for d4gcoa_ (4gco A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279354Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1279560Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 1279561Protein automated matches [191037] (8 species)
    not a true protein
  7. 1279576Species Nematode (Caenorhabditis elegans) [TaxId:6239] [226441] (1 PDB entry)
  8. 1279577Domain d4gcoa_: 4gco A: [221840]
    automated match to d1elwb_

Details for d4gcoa_

PDB Entry: 4gco (more details), 1.6 Å

PDB Description: central domain of stress-induced protein-1 (sti-1) from c.elegans
PDB Compounds: (A:) Protein STI-1

SCOPe Domain Sequences for d4gcoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gcoa_ a.118.8.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
yinpelaqeeknkgneyfkkgdyptamrhyneavkrdpenailysnraacltklmefqra
lddcdtcirldskfikgyirkaaclvamrewskaqrayedalqvdpsneearegvrnclr

SCOPe Domain Coordinates for d4gcoa_:

Click to download the PDB-style file with coordinates for d4gcoa_.
(The format of our PDB-style files is described here.)

Timeline for d4gcoa_: