![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
![]() | Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
![]() | Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
![]() | Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries) Coagulation factor XIII, |
![]() | Domain d1ggya3: 1ggy A:628-727 [22184] Other proteins in same PDB: d1ggya1, d1ggya4, d1ggyb1, d1ggyb4 complexed with yb |
PDB Entry: 1ggy (more details), 2.5 Å
SCOPe Domain Sequences for d1ggya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggya3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
Timeline for d1ggya3:
![]() Domains from other chains: (mouse over for more information) d1ggyb1, d1ggyb2, d1ggyb3, d1ggyb4 |