Lineage for d4gb1a_ (4gb1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553917Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1553918Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1554303Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 1554304Protein automated matches [190692] (9 species)
    not a true protein
  7. 1554328Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries)
  8. 1554360Domain d4gb1a_: 4gb1 A: [221829]
    automated match to d4d8sa_
    complexed with 0lp, ca

Details for d4gb1a_

PDB Entry: 4gb1 (more details), 2.62 Å

PDB Description: synthesis and evaluation of novel 3-c-alkylated-neu5ac2en derivatives as probes of influenza virus sialidase 150-loop flexibility
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d4gb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gb1a_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

SCOPe Domain Coordinates for d4gb1a_:

Click to download the PDB-style file with coordinates for d4gb1a_.
(The format of our PDB-style files is described here.)

Timeline for d4gb1a_: