SCOPe 2.08: Domain d4gayl2: 4gay L:108-211

Lineage for d4gayl2 (4gay L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4gayl2: 4gay L:108-211 [221828]
   Other proteins in same PDB: d4gaya_, d4gayb1, d4gayh_, d4gayl1
   automated match to d1tqbc2
   complexed with pge

Details for d4gayl2

PDB Entry: 4gay, 2.65 Å

PDB Description: Structure of the broadly neutralizing antibody AP33

PDB Compounds: (L:) neutralizing antibody ap33 light chain

SCOPe Domain Sequences for d4gayl2:

Sequence, based on SEQRES records:

>d4gayl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records):

>d4gayl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsengvlnswtdqdsk
dstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d4gayl2:

• d4gayl2 first appeared in SCOPe 2.03
  
• d4gayl2 appears in SCOPe 2.07