| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d4gayl2: 4gay L:108-211 [221828] Other proteins in same PDB: d4gaya_, d4gayb1, d4gayh_, d4gayl1 automated match to d1tqbc2 complexed with pge |
PDB Entry: 4gay (more details), 2.65 Å
SCOPe Domain Sequences for d4gayl2:
Sequence, based on SEQRES records: (download)
>d4gayl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
>d4gayl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsengvlnswtdqdsk
dstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d4gayl2:
View in 3DDomains from other chains: (mouse over for more information) d4gaya_, d4gayb1, d4gayb2, d4gayh_ |