SCOPe 2.08: Domain d4gayb1: 4gay B:1-107

Lineage for d4gayb1 (4gay B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4gayb1: 4gay B:1-107 [221825]
   Other proteins in same PDB: d4gaya_, d4gayb2, d4gayh_, d4gayl2
   automated match to d1a5fl1
   complexed with pge

Details for d4gayb1

PDB Entry: 4gay, 2.65 Å

PDB Description: Structure of the broadly neutralizing antibody AP33

PDB Compounds: (B:) neutralizing antibody ap33 light chain

SCOPe Domain Sequences for d4gayb1:

Sequence; same for both SEQRES and ATOM records:

>d4gayb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nivltqspvslavslgqratiscrasesvdgygnsflhwfqqkpgqppklliylasnlns
gvparfsgsgsrtdftltidpveaddaatyycqqnnvdpwtfgggtkleik

Timeline for d4gayb1:

• d4gayb1 first appeared in SCOPe 2.03
  
• d4gayb1 appears in SCOPe 2.07