Lineage for d4gaxa1 (4gax A:13-218)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722844Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2722845Protein automated matches [226931] (12 species)
    not a true protein
  7. 2722846Species Artemisia annua [TaxId:35608] [226616] (2 PDB entries)
  8. 2722848Domain d4gaxa1: 4gax A:13-218 [221823]
    Other proteins in same PDB: d4gaxa2
    automated match to d1hxga1
    mutant

Details for d4gaxa1

PDB Entry: 4gax (more details), 1.99 Å

PDB Description: crystal structure of an alpha-bisabolol synthase mutant
PDB Compounds: (A:) Amorpha-4,11-diene synthase

SCOPe Domain Sequences for d4gaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gaxa1 a.102.4.0 (A:13-218) automated matches {Artemisia annua [TaxId: 35608]}
anfspsiwgdqflivdnqveqgveqivkdlkkevrqllkealdipmkhanllklvdeiqr
lgisylfeqeidhalqhiyetygdnwsgarsslwfrlmrkqgyfvtcdvfnnhkdesgvf
kqslknhvegllelyeatsmrvpgeiiledalvftqshlsiiakdtlsinpalsteiqra
lkkplwkrlprieavqyipfyeqqds

SCOPe Domain Coordinates for d4gaxa1:

Click to download the PDB-style file with coordinates for d4gaxa1.
(The format of our PDB-style files is described here.)

Timeline for d4gaxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gaxa2