SCOPe 2.07: Domain d4ga9b_: 4ga9 B:

Lineage for d4ga9b_ (4ga9 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [190017] (3 PDB entries)

8. Domain d4ga9b_: 4ga9 B: [221822]
   automated match to d1slta_
   complexed with lbt

Details for d4ga9b_

PDB Entry: 4ga9, 1.88 Å

PDB Description: crystal structure of rat galectin-1 in complex with lactose

PDB Compounds: (B:) galectin-1

SCOPe Domain Sequences for d4ga9b_:

Sequence; same for both SEQRES and ATOM records:

>d4ga9b_ b.29.1.3 (B:) Galectin-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
acglvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkvkcvafe

Timeline for d4ga9b_:

• d4ga9b_ first appeared in SCOPe 2.03
  
• d4ga9b_ appears in SCOPe 2.06
  
• d4ga9b_ appears in the current release, SCOPe 2.08