SCOPe 2.05: Domain d4g9hb2: 4g9h B:82-201

Lineage for d4g9hb2 (4g9h B:82-201)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (51 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226439] (3 PDB entries)

8. Domain d4g9hb2: 4g9h B:82-201 [221815]
   Other proteins in same PDB: d4g9ha1, d4g9hb1
   automated match to d1n2aa1
   complexed with gol, gsh

Details for d4g9hb2

PDB Entry: 4g9h, 2.1 Å

PDB Description: Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target EFI-501894, with bound glutathione

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4g9hb2:

Sequence; same for both SEQRES and ATOM records:

>d4g9hb2 a.45.1.0 (B:82-201) automated matches {Yersinia pestis [TaxId: 632]}
hliapsgtlsryhaiewlnfiatelhkgfsplfnpntpdeyktivrerldkqfsyvdsvl
aehdyllgkkfsvadaylftvsrwanalnlqikershldqymarvaerpavkaalaaedi

Timeline for d4g9hb2:

• d4g9hb2 first appeared in SCOPe 2.03
  
• d4g9hb2 appears in SCOPe 2.04
  
• d4g9hb2 appears in SCOPe 2.06
  
• d4g9hb2 appears in the current release, SCOPe 2.08