Lineage for d4g9hb2 (4g9h B:82-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714345Species Yersinia pestis [TaxId:632] [226439] (3 PDB entries)
  8. 2714351Domain d4g9hb2: 4g9h B:82-201 [221815]
    Other proteins in same PDB: d4g9ha1, d4g9ha3, d4g9hb1, d4g9hb3
    automated match to d1n2aa1
    complexed with gol, gsh

Details for d4g9hb2

PDB Entry: 4g9h (more details), 2.1 Å

PDB Description: Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target EFI-501894, with bound glutathione
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4g9hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g9hb2 a.45.1.0 (B:82-201) automated matches {Yersinia pestis [TaxId: 632]}
hliapsgtlsryhaiewlnfiatelhkgfsplfnpntpdeyktivrerldkqfsyvdsvl
aehdyllgkkfsvadaylftvsrwanalnlqikershldqymarvaerpavkaalaaedi

SCOPe Domain Coordinates for d4g9hb2:

Click to download the PDB-style file with coordinates for d4g9hb2.
(The format of our PDB-style files is described here.)

Timeline for d4g9hb2: