![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:632] [226439] (3 PDB entries) |
![]() | Domain d4g9ha2: 4g9h A:82-201 [221813] Other proteins in same PDB: d4g9ha1, d4g9ha3, d4g9hb1, d4g9hb3 automated match to d1n2aa1 complexed with gol, gsh |
PDB Entry: 4g9h (more details), 2.1 Å
SCOPe Domain Sequences for d4g9ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g9ha2 a.45.1.0 (A:82-201) automated matches {Yersinia pestis [TaxId: 632]} hliapsgtlsryhaiewlnfiatelhkgfsplfnpntpdeyktivrerldkqfsyvdsvl aehdyllgkkfsvadaylftvsrwanalnlqikershldqymarvaerpavkaalaaedi
Timeline for d4g9ha2: