SCOPe 2.05: Domain d4g9ha1: 4g9h A:0-81

Lineage for d4g9ha1 (4g9h A:0-81)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226438] (3 PDB entries)

8. Domain d4g9ha1: 4g9h A:0-81 [221812]
   Other proteins in same PDB: d4g9ha2, d4g9hb2
   automated match to d1n2aa2
   complexed with gol, gsh

Details for d4g9ha1

PDB Entry: 4g9h, 2.1 Å

PDB Description: Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target EFI-501894, with bound glutathione

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4g9ha1:

Sequence; same for both SEQRES and ATOM records:

>d4g9ha1 c.47.1.0 (A:0-81) automated matches {Yersinia pestis [TaxId: 632]}
vmmklfykpgacslsphivlreagldfsiervdlvtkktetgadylsinpkgqvpalvld
dgslltegvaivqyladkvpdr

Timeline for d4g9ha1:

• d4g9ha1 first appeared in SCOPe 2.03
  
• d4g9ha1 appears in SCOPe 2.04
  
• d4g9ha1 appears in SCOPe 2.06
  
• d4g9ha1 appears in the current release, SCOPe 2.08