Lineage for d4g9ac_ (4g9a C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442648Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)
  7. 1442649Species Human (Homo sapiens) [TaxId:9606] [143958] (10 PDB entries)
    Uniprot P06734 156-298
  8. 1442652Domain d4g9ac_: 4g9a C: [221809]
    automated match to d1t8ca1
    complexed with ca, gol

Details for d4g9ac_

PDB Entry: 4g9a (more details), 2 Å

PDB Description: Crystal structure of calcium2+-bound wild-type CD23 lectin domain
PDB Compounds: (C:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4g9ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g9ac_ d.169.1.1 (C:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
cntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhashtgs
wiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrklga
wvcdrlatct

SCOPe Domain Coordinates for d4g9ac_:

Click to download the PDB-style file with coordinates for d4g9ac_.
(The format of our PDB-style files is described here.)

Timeline for d4g9ac_: