Class a: All alpha proteins [46456] (290 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) automatically mapped to Pfam PF01126 |
Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries) Uniprot P06762 11-222 |
Domain d4g99a_: 4g99 A: [221806] automated match to d1j02a_ complexed with cmo, fmt, hem |
PDB Entry: 4g99 (more details), 2.3 Å
SCOPe Domain Sequences for d4g99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g99a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]} qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle mtpevkhrvteeaktafllnielfeelqallt
Timeline for d4g99a_: