![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
![]() | Protein automated matches [193280] (1 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:93061] [193281] (3 PDB entries) |
![]() | Domain d4g94a_: 4g94 A: [221800] automated match to d1rioh_ protein/DNA complex; protein/RNA complex |
PDB Entry: 4g94 (more details), 2 Å
SCOPe Domain Sequences for d4g94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g94a_ a.4.13.2 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]} mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr hp
Timeline for d4g94a_: