Lineage for d4g94a_ (4g94 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1985191Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1985225Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1985276Protein automated matches [193280] (1 species)
    not a true protein
  7. 1985277Species Staphylococcus aureus [TaxId:93061] [193281] (3 PDB entries)
  8. 1985279Domain d4g94a_: 4g94 A: [221800]
    automated match to d1rioh_
    protein/DNA complex; protein/RNA complex

Details for d4g94a_

PDB Entry: 4g94 (more details), 2 Å

PDB Description: G1 ORF67 / Staphyloccus aureus sigmaA domain 4 complex
PDB Compounds: (A:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d4g94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g94a_ a.4.13.2 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
mkeqledvldtltdreenvlrlrfglddgrtrtleevgkvfgvtrerirqieakalrklr
hp

SCOPe Domain Coordinates for d4g94a_:

Click to download the PDB-style file with coordinates for d4g94a_.
(The format of our PDB-style files is described here.)

Timeline for d4g94a_: