| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
| Protein automated matches [194413] (5 species) not a true protein |
| Species Aspergillus nidulans [TaxId:227321] [194414] (2 PDB entries) |
| Domain d4g91b_: 4g91 B: [221799] automated match to d4g92b_ |
PDB Entry: 4g91 (more details), 1.9 Å
SCOPe Domain Sequences for d4g91b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g91b_ a.22.1.3 (B:) automated matches {Aspergillus nidulans [TaxId: 227321]}
keqdrwlpianvarimklalpenakiakeakecmqecvsefisfitseasekcqqekrkt
vngedilfamtslgfenyaealkiylskyre
Timeline for d4g91b_: