Lineage for d4g8wa_ (4g8w A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732664Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2732724Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
    Uniprot P06762 11-222
  8. 2732739Domain d4g8wa_: 4g8w A: [221798]
    automated match to d1ix3a_
    complexed with fmt, hem, oxy

Details for d4g8wa_

PDB Entry: 4g8w (more details), 2.4 Å

PDB Description: rat heme oxygenase-1 in complex with heme and o2 with 13 hr illumination: laser on
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d4g8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g8wa_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallte

SCOPe Domain Coordinates for d4g8wa_:

Click to download the PDB-style file with coordinates for d4g8wa_.
(The format of our PDB-style files is described here.)

Timeline for d4g8wa_: