| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
| Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) automatically mapped to Pfam PF01126 |
| Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries) Uniprot P06762 11-222 |
| Domain d4g8ua_: 4g8u A: [221797] automated match to d1ix3a_ complexed with fmt, hem, oxy |
PDB Entry: 4g8u (more details), 2.1 Å
SCOPe Domain Sequences for d4g8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g8ua_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallte
Timeline for d4g8ua_: