Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries) |
Domain d4g8tc1: 4g8t C:2-133 [221793] Other proteins in same PDB: d4g8ta2, d4g8tb2, d4g8tc2, d4g8td2 automated match to d1ec7a2 complexed with dtt, dtu, gol, na, so4 |
PDB Entry: 4g8t (more details), 1.7 Å
SCOPe Domain Sequences for d4g8tc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g8tc1 d.54.1.0 (C:2-133) automated matches {Actinobacillus succinogenes [TaxId: 339671]} stpiitemqvipvaghdsmllnlsgahspyftrnivilkdnsgntgvgevpggekirqtl edakplvigktlgeyknvmntvrqtfndhdaggrglqtfdlrttihvvtaieaamldllg qflgvtvasllg
Timeline for d4g8tc1: