Lineage for d4g8tb1 (4g8t B:2-133)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947883Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)
  8. 2947885Domain d4g8tb1: 4g8t B:2-133 [221791]
    Other proteins in same PDB: d4g8ta2, d4g8tb2, d4g8tc2, d4g8td2
    automated match to d1ec7a2
    complexed with dtt, dtu, gol, na, so4

Details for d4g8tb1

PDB Entry: 4g8t (more details), 1.7 Å

PDB Description: Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target EFI-502312, with sodium and sulfate bound, ordered loop
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4g8tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g8tb1 d.54.1.0 (B:2-133) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
stpiitemqvipvaghdsmllnlsgahspyftrnivilkdnsgntgvgevpggekirqtl
edakplvigktlgeyknvmntvrqtfndhdaggrglqtfdlrttihvvtaieaamldllg
qflgvtvasllg

SCOPe Domain Coordinates for d4g8tb1:

Click to download the PDB-style file with coordinates for d4g8tb1.
(The format of our PDB-style files is described here.)

Timeline for d4g8tb1: