Lineage for d4g8ta2 (4g8t A:134-442)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1343858Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)
  6. 1344048Protein automated matches [226997] (6 species)
    not a true protein
  7. 1344052Species Actinobacillus succinogenes [TaxId:339671] [226437] (1 PDB entry)
  8. 1344053Domain d4g8ta2: 4g8t A:134-442 [221790]
    Other proteins in same PDB: d4g8ta1, d4g8tb1, d4g8tc1, d4g8td1
    automated match to d1ec7a1
    complexed with dtt, dtu, gol, na, so4

Details for d4g8ta2

PDB Entry: 4g8t (more details), 1.7 Å

PDB Description: Crystal structure of a glucarate dehydratase related protein, from actinobacillus succinogenes, target EFI-502312, with sodium and sulfate bound, ordered loop
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d4g8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g8ta2 c.1.11.2 (A:134-442) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
dgqqrdavemlgylffigdrkkttlayqnqendpcdwyrvrheeamtpesvvrlaeaaye
kygfndfklkggvldgfeeaeavtalakrfpdaritldpngawsldeavkigkqlkgvla
yaedpcgaeqgysgreimaefrratglptatnmiatdwrqmghtislqsvdipladphfw
tmqgsirvaqmchewgltwgshsnnhfdislamfthvaaaapgditaidthwiwqegnqr
ltkepfqikgglvevpkkpglgveldmdqvmkanelyksmglgarddamamqflipgwkf
dnkkpclvr

SCOPe Domain Coordinates for d4g8ta2:

Click to download the PDB-style file with coordinates for d4g8ta2.
(The format of our PDB-style files is described here.)

Timeline for d4g8ta2: