Lineage for d1ggua2 (1ggu A:516-627)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10036Superfamily b.1.5: Transglutaminase [49309] (1 family) (S)
  5. 10037Family b.1.5.1: Transglutaminase [49310] (1 protein)
  6. 10038Protein Coagulation factor XIII, two C-terminal domains [49311] (1 species)
  7. 10039Species Human (Homo sapiens), blood [TaxId:9606] [49312] (7 PDB entries)
  8. 10048Domain d1ggua2: 1ggu A:516-627 [22179]
    Other proteins in same PDB: d1ggua1, d1ggua4, d1ggub1, d1ggub4

Details for d1ggua2

PDB Entry: 1ggu (more details), 2.1 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1ggua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggua2 b.1.5.1 (A:516-627) Coagulation factor XIII, two C-terminal domains {Human (Homo sapiens), blood}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

SCOP Domain Coordinates for d1ggua2:

Click to download the PDB-style file with coordinates for d1ggua2.
(The format of our PDB-style files is described here.)

Timeline for d1ggua2: