Lineage for d4g8na_ (4g8n A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523133Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2523299Domain d4g8na_: 4g8n A: [221785]
    automated match to d4igra_
    complexed with cl, g8m, k

Details for d4g8na_

PDB Entry: 4g8n (more details), 2.3 Å

PDB Description: crystal structure of the kainate receptor gluk3 ligand-binding domain in complex with the agonist g8m
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 3

SCOPe Domain Sequences for d4g8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g8na_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tnrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgky
gaqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpid
saddlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlt
adyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedk
lhimkekwwrgsgcp

SCOPe Domain Coordinates for d4g8na_:

Click to download the PDB-style file with coordinates for d4g8na_.
(The format of our PDB-style files is described here.)

Timeline for d4g8na_: