Lineage for d4g8fa1 (4g8f A:3-128)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765529Domain d4g8fa1: 4g8f A:3-128 [221772]
    Other proteins in same PDB: d4g8fa2, d4g8fb2
    automated match to d2esvd1

Details for d4g8fa1

PDB Entry: 4g8f (more details), 2.1 Å

PDB Description: crystal structure of clone42 tcr
PDB Compounds: (A:) alpha chain clone 42 TCR

SCOPe Domain Sequences for d4g8fa1:

Sequence, based on SEQRES records: (download)

>d4g8fa1 b.1.1.0 (A:3-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfss
flsrskgysylllkelqmkdsasylcavrntggfktifgagtrlfvkan

Sequence, based on observed residues (ATOM records): (download)

>d4g8fa1 b.1.1.0 (A:3-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfss
flsrskgysylllkelqmkdsasylcavrngfktifgagtrlfvkan

SCOPe Domain Coordinates for d4g8fa1:

Click to download the PDB-style file with coordinates for d4g8fa1.
(The format of our PDB-style files is described here.)

Timeline for d4g8fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g8fa2