SCOP 1.57: Domain d1evub2: 1evu B:515-627

Lineage for d1evub2 (1evu B:515-627)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49312] (7 PDB entries)

8. Domain d1evub2: 1evu B:515-627 [22177]
   Other proteins in same PDB: d1evua1, d1evua4, d1evub1, d1evub4

Details for d1evub2

PDB Entry: 1evu, 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1evub2:

Sequence; same for both SEQRES and ATOM records:

>d1evub2 b.1.5.1 (B:515-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens)}
rsnvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfd
vtleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

Timeline for d1evub2:

• d1evub2 first appeared (with stable ids) in SCOP 1.55
  
• d1evub2 appears in SCOP 1.59
  
• d1evub2 appears in the current release, SCOPe 2.08