![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
![]() | Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
![]() | Protein automated matches [195455] (5 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries) |
![]() | Domain d4g88f_: 4g88 F: [221765] automated match to d2hqsc_ complexed with api, srt |
PDB Entry: 4g88 (more details), 1.7 Å
SCOPe Domain Sequences for d4g88f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g88f_ d.79.7.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 470]} shmeltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprk lnerlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitg sr
Timeline for d4g88f_: