SCOP 1.67: Domain d1evua3: 1evu A:628-727

Lineage for d1evua3 (1evu A:628-727)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries)
   Coagulation factor XIII,

8. Domain d1evua3: 1evu A:628-727 [22176]
   Other proteins in same PDB: d1evua1, d1evua4, d1evub1, d1evub4

Details for d1evua3

PDB Entry: 1evu, 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site

SCOP Domain Sequences for d1evua3:

Sequence; same for both SEQRES and ATOM records:

>d1evua3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme}
tipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

Timeline for d1evua3:

• d1evua3 first appeared (with stable ids) in SCOP 1.55
  
• d1evua3 appears in SCOP 1.65
  
• d1evua3 appears in SCOP 1.69
  
• d1evua3 appears in the current release, SCOPe 2.08