SCOPe 2.03: Domain d4g7ta_: 4g7t A:

Lineage for d4g7ta_ (4g7t A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
   Uniprot P06762 11-222

8. Domain d4g7ta_: 4g7t A: [221756]
   automated match to d1j02a_
   complexed with cmo, fmt, hem

Details for d4g7ta_

PDB Entry: 4g7t, 1.9 Å

PDB Description: rat heme oxygenase-1 in complex with heme and co with 1 hr illumination: laser on

PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d4g7ta_:

Sequence; same for both SEQRES and ATOM records:

>d4g7ta_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

Timeline for d4g7ta_:

• d4g7ta_ is new in SCOPe 2.03-stable
  
• d4g7ta_ appears in SCOPe 2.04
  
• d4g7ta_ appears in the current release, SCOPe 2.08