Lineage for d4g7ta_ (4g7t A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732664Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2732724Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
    Uniprot P06762 11-222
  8. 2732746Domain d4g7ta_: 4g7t A: [221756]
    automated match to d1j02a_
    complexed with cmo, fmt, hem

Details for d4g7ta_

PDB Entry: 4g7t (more details), 1.9 Å

PDB Description: rat heme oxygenase-1 in complex with heme and co with 1 hr illumination: laser on
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d4g7ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7ta_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallt

SCOPe Domain Coordinates for d4g7ta_:

Click to download the PDB-style file with coordinates for d4g7ta_.
(The format of our PDB-style files is described here.)

Timeline for d4g7ta_: