Lineage for d4g7sc_ (4g7s C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630966Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 2630967Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins)
  6. 2630968Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 2630969Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries)
  8. 2630970Domain d4g7sc_: 4g7s C: [221755]
    Other proteins in same PDB: d4g7sa_, d4g7sb1, d4g7sb2
    automated match to d1xmec_
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g7sc_

PDB Entry: 4g7s (more details), 2 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236I from Thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d4g7sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7sc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
kpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d4g7sc_:

Click to download the PDB-style file with coordinates for d4g7sc_.
(The format of our PDB-style files is described here.)

Timeline for d4g7sc_: