Lineage for d4g7fa1 (4g7f A:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948665Species Trypanosoma cruzi [TaxId:353153] [226457] (1 PDB entry)
  8. 2948666Domain d4g7fa1: 4g7f A:1-138 [221742]
    Other proteins in same PDB: d4g7fa2
    automated match to d1oepa2
    complexed with edo, mg

Details for d4g7fa1

PDB Entry: 4g7f (more details), 2.4 Å

PDB Description: Crystal Structure of Enolase from Trypanosoma Cruzi
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d4g7fa1:

Sequence, based on SEQRES records: (download)

>d4g7fa1 d.54.1.0 (A:1-138) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mtiqkvhgreildsrgnptvevevttelgvfrsavpsgastgiheacelrdddkrrylgk
gclnavknvndvlapalvgkdelqqstldklmrdldgtpnksklganailgcsmaiskaa
aarkgvplyrylaelagt

Sequence, based on observed residues (ATOM records): (download)

>d4g7fa1 d.54.1.0 (A:1-138) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mtiqkvhgreildsrgnptvevevttelgvfrsavpsgiheacelrdddkrrylgkgcln
avknvndvlapalvgkdelqqstldklmrdldgtpnksklganailgcsmaiskaaaark
gvplyrylaelagt

SCOPe Domain Coordinates for d4g7fa1:

Click to download the PDB-style file with coordinates for d4g7fa1.
(The format of our PDB-style files is described here.)

Timeline for d4g7fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g7fa2