SCOPe 2.05: Domain d4g71b2: 4g71 B:41-168

Lineage for d4g71b2 (4g71 B:41-168)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (30 PDB entries)

8. Domain d4g71b2: 4g71 B:41-168 [221739]
   Other proteins in same PDB: d4g71a_, d4g71b1, d4g71c_
   automated match to d1ehkb1
   complexed with cua, cub, has, hem, olc, per; mutant

Details for d4g71b2

PDB Entry: 4g71, 2.9 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236N from Thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d4g71b2:

Sequence; same for both SEQRES and ATOM records:

>d4g71b2 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

Timeline for d4g71b2:

• d4g71b2 first appeared in SCOPe 2.03
  
• d4g71b2 appears in SCOPe 2.04
  
• d4g71b2 appears in SCOPe 2.06
  
• d4g71b2 appears in the current release, SCOPe 2.08