| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) ![]() |
| Family a.97.1.0: automated matches [227179] (1 protein) not a true family |
| Protein automated matches [226898] (7 species) not a true protein |
| Species Burkholderia thailandensis [TaxId:271848] [226428] (1 PDB entry) |
| Domain d4g6za2: 4g6z A:305-466 [221734] Other proteins in same PDB: d4g6za1 automated match to d1j09a1 complexed with cl, glu, mpd, na |
PDB Entry: 4g6z (more details), 2.05 Å
SCOPe Domain Sequences for d4g6za2:
Sequence, based on SEQRES records: (download)
>d4g6za2 a.97.1.0 (A:305-466) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dhnklnwlnnhyikeaddarlaglakpffaalgidagaieqgpdlvsvmglmkdrastvk
eiaensamfyrapapgadalaqhvtdavrpalvefaaalktvewtkeaiaaalkavlgah
klkmpqlampvrllvagtthtpsidavlllfgrdvvvsriea
>d4g6za2 a.97.1.0 (A:305-466) automated matches {Burkholderia thailandensis [TaxId: 271848]}
dhnklnwlnnhyikeaddarlaglakpffaalgidagaieqgpdlvsvmglmkdrastvk
eiaensamfyrapahtpsidavlllfgrdvvvsriea
Timeline for d4g6za2: