Lineage for d1ggtb2 (1ggt B:516-627)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373287Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 2373288Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 2373289Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 2373290Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (9 PDB entries)
    Coagulation factor XIII,
  8. 2373325Domain d1ggtb2: 1ggt B:516-627 [22173]
    Other proteins in same PDB: d1ggta1, d1ggta4, d1ggtb1, d1ggtb4

Details for d1ggtb2

PDB Entry: 1ggt (more details), 2.65 Å

PDB Description: three-dimensional structure of a transglutaminase: human blood coagulation factor xiii
PDB Compounds: (B:) coagulation factor xiii

SCOPe Domain Sequences for d1ggtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggtb2 b.1.5.1 (B:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

SCOPe Domain Coordinates for d1ggtb2:

Click to download the PDB-style file with coordinates for d1ggtb2.
(The format of our PDB-style files is described here.)

Timeline for d1ggtb2: