SCOPe 2.04: Domain d4g51d_: 4g51 D:

Lineage for d4g51d_ (4g51 D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (11 PDB entries)

8. Domain d4g51d_: 4g51 D: [221727]
   Other proteins in same PDB: d4g51a_, d4g51c_
   automated match to d1pbxb_
   complexed with hem, no

Details for d4g51d_

PDB Entry: 4g51, 2.5 Å

PDB Description: crystallographic analysis of the interaction of nitric oxide with hemoglobin from trematomus bernacchii in the t quaternary structure (fully ligated state).

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4g51d_:

Sequence; same for both SEQRES and ATOM records:

>d4g51d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d4g51d_:

• d4g51d_ first appeared in SCOPe 2.03
  
• d4g51d_ appears in SCOPe 2.05
  
• d4g51d_ appears in the current release, SCOPe 2.08