Lineage for d4g51b_ (4g51 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254600Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1254667Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (11 PDB entries)
  8. 1254684Domain d4g51b_: 4g51 B: [221725]
    Other proteins in same PDB: d4g51a_, d4g51c_
    automated match to d1pbxb_
    complexed with hem, no

Details for d4g51b_

PDB Entry: 4g51 (more details), 2.5 Å

PDB Description: crystallographic analysis of the interaction of nitric oxide with hemoglobin from trematomus bernacchii in the t quaternary structure (fully ligated state).
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4g51b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g51b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d4g51b_:

Click to download the PDB-style file with coordinates for d4g51b_.
(The format of our PDB-style files is described here.)

Timeline for d4g51b_: