Lineage for d4g4zf_ (4g4z F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1421395Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 1421417Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 1421418Protein automated matches [195455] (5 species)
    not a true protein
  7. 1421419Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)
  8. 1421457Domain d4g4zf_: 4g4z F: [221721]
    automated match to d2hqsc_
    complexed with dal, so4

Details for d4g4zf_

PDB Entry: 4g4z (more details), 1.8 Å

PDB Description: crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
PDB Compounds: (F:) Outer membrane protein omp38

SCOPe Domain Sequences for d4g4zf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4zf_ d.79.7.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 470]}
shmeltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprk
lnerlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitg
sr

SCOPe Domain Coordinates for d4g4zf_:

Click to download the PDB-style file with coordinates for d4g4zf_.
(The format of our PDB-style files is described here.)

Timeline for d4g4zf_: