| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
| Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
| Protein automated matches [195455] (5 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries) |
| Domain d4g4zf_: 4g4z F: [221721] automated match to d2hqsc_ complexed with dal, so4 |
PDB Entry: 4g4z (more details), 1.8 Å
SCOPe Domain Sequences for d4g4zf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g4zf_ d.79.7.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 470]}
shmeltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprk
lnerlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitg
sr
Timeline for d4g4zf_: