Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) |
Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
Protein automated matches [195455] (14 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries) |
Domain d4g4zf1: 4g4z F:221-339 [221721] Other proteins in same PDB: d4g4za2, d4g4zb2, d4g4zd2, d4g4ze2, d4g4zf2, d4g4zg2, d4g4zh2 automated match to d2hqsc_ complexed with dal, so4 |
PDB Entry: 4g4z (more details), 1.8 Å
SCOPe Domain Sequences for d4g4zf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g4zf1 d.79.7.0 (F:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]} eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr
Timeline for d4g4zf1: