SCOPe 2.08: Domain d4g4zf1: 4g4z F:221-339

Lineage for d4g4zf1 (4g4z F:221-339)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)

8. Domain d4g4zf1: 4g4z F:221-339 [221721]
   Other proteins in same PDB: d4g4za2, d4g4zb2, d4g4zd2, d4g4ze2, d4g4zf2, d4g4zg2, d4g4zh2
   automated match to d2hqsc_
   complexed with dal, so4

Details for d4g4zf1

PDB Entry: 4g4z, 1.8 Å

PDB Description: crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii

PDB Compounds: (F:) Outer membrane protein omp38

SCOPe Domain Sequences for d4g4zf1:

Sequence; same for both SEQRES and ATOM records:

>d4g4zf1 d.79.7.0 (F:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]}
eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne
rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr

Timeline for d4g4zf1:

• d4g4zf1 first appeared in SCOPe 2.03, called d4g4zf_
  
• d4g4zf1 appears in SCOPe 2.07