Lineage for d4g4zf1 (4g4z F:221-339)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960636Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)
  8. 2960674Domain d4g4zf1: 4g4z F:221-339 [221721]
    Other proteins in same PDB: d4g4za2, d4g4zb2, d4g4zd2, d4g4ze2, d4g4zf2, d4g4zg2, d4g4zh2
    automated match to d2hqsc_
    complexed with dal, so4

Details for d4g4zf1

PDB Entry: 4g4z (more details), 1.8 Å

PDB Description: crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii
PDB Compounds: (F:) Outer membrane protein omp38

SCOPe Domain Sequences for d4g4zf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4zf1 d.79.7.0 (F:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]}
eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne
rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr

SCOPe Domain Coordinates for d4g4zf1:

Click to download the PDB-style file with coordinates for d4g4zf1.
(The format of our PDB-style files is described here.)

Timeline for d4g4zf1: