SCOPe 2.08: Domain d4g4ye1: 4g4y E:221-339

Lineage for d4g4ye1 (4g4y E:221-339)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [224937] (5 PDB entries)

8. Domain d4g4ye1: 4g4y E:221-339 [221712]
   Other proteins in same PDB: d4g4ya2, d4g4yb2, d4g4yc2, d4g4yd2, d4g4ye2, d4g4yf2, d4g4yg2, d4g4yh2
   automated match to d2hqsc_
   complexed with ala, so4

Details for d4g4ye1

PDB Entry: 4g4y, 1.7 Å

PDB Description: crystal structure of ompa peptidoglycan-binding domain from acinetobacter baumannii

PDB Compounds: (E:) Outer membrane protein omp38

SCOPe Domain Sequences for d4g4ye1:

Sequence; same for both SEQRES and ATOM records:

>d4g4ye1 d.79.7.0 (E:221-339) automated matches {Acinetobacter baumannii [TaxId: 470]}
eltedlnmelrvffdtnksnikdqykpeiakvaeklseypnatarieghtdntgprklne
rlslaransvksalvneynvdasrlstqgfawdqpiadnktkegramnrrvfatitgsr

Timeline for d4g4ye1:

• d4g4ye1 first appeared in SCOPe 2.03, called d4g4ye_
  
• d4g4ye1 appears in SCOPe 2.07