Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) |
Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
Protein automated matches [195455] (14 species) not a true protein |
Species Acinetobacter baumannii [TaxId:980514] [226730] (3 PDB entries) |
Domain d4g4va1: 4g4v A:75-184 [221705] Other proteins in same PDB: d4g4va2 automated match to d4erhb_ complexed with api |
PDB Entry: 4g4v (more details), 1.9 Å
SCOPe Domain Sequences for d4g4va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g4va1 d.79.7.0 (A:75-184) automated matches {Acinetobacter baumannii [TaxId: 980514]} alakrvvhfdydssdlstedyqtlqahaqflmananskvaltghtdergtreynmalger rakavqnylitsgvnpqqleavsygkeapvnpghdesawkenrrveinye
Timeline for d4g4va1: