Lineage for d4g44a_ (4g44 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004955Protein Cyp121 monooxygenase (P450 Mt2) [81865] (2 species)
  7. 2004956Species Mycobacterium tuberculosis [TaxId:1773] [81866] (35 PDB entries)
  8. 2004960Domain d4g44a_: 4g44 A: [221696]
    automated match to d1n40a_
    complexed with hem, so4, tzm

Details for d4g44a_

PDB Entry: 4g44 (more details), 1.24 Å

PDB Description: Structure of P450 CYP121 in complex with lead compound MB286, 3-((1H-1,2,4-triazol-1-yl)methyl)aniline
PDB Compounds: (A:) Cytochrome P450 121

SCOPe Domain Sequences for d4g44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g44a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsf
lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
llkkmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d4g44a_:

Click to download the PDB-style file with coordinates for d4g44a_.
(The format of our PDB-style files is described here.)

Timeline for d4g44a_: