Lineage for d4g3sa1 (4g3s A:6-263)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1868080Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1868081Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1868928Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 1868929Protein automated matches [190951] (23 species)
    not a true protein
  7. 1868995Species Mycobacterium tuberculosis [TaxId:1773] [224907] (7 PDB entries)
  8. 1868997Domain d4g3sa1: 4g3s A:6-263 [221694]
    Other proteins in same PDB: d4g3sa2
    automated match to d1hm9a2
    complexed with co, gn1, mg, pop, ud1

Details for d4g3sa1

PDB Entry: 4g3s (more details), 2.04 Å

PDB Description: crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine and pyrophosphate snapshot 2
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4g3sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g3sa1 c.68.1.0 (A:6-263) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
elaselnrrvvaahqlag

SCOPe Domain Coordinates for d4g3sa1:

Click to download the PDB-style file with coordinates for d4g3sa1.
(The format of our PDB-style files is described here.)

Timeline for d4g3sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g3sa2