Lineage for d4g3pa2 (4g3p A:264-474)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814310Species Mycobacterium tuberculosis [TaxId:1773] [224870] (7 PDB entries)
  8. 2814314Domain d4g3pa2: 4g3p A:264-474 [221691]
    Other proteins in same PDB: d4g3pa1
    automated match to d1g95a1
    complexed with co, mg, pop, ud1

Details for d4g3pa2

PDB Entry: 4g3p (more details), 2.47 Å

PDB Description: Crystal structure of GlmU from Mycobacterium tuberculosis Snapshot 3
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4g3pa2:

Sequence, based on SEQRES records: (download)

>d4g3pa2 b.81.1.0 (A:264-474) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrkrpgspaaqas

Sequence, based on observed residues (ATOM records): (download)

>d4g3pa2 b.81.1.0 (A:264-474) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvppgalavs
agpqrnienwvqrkrpgspaaqas

SCOPe Domain Coordinates for d4g3pa2:

Click to download the PDB-style file with coordinates for d4g3pa2.
(The format of our PDB-style files is described here.)

Timeline for d4g3pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g3pa1