Lineage for d4g3md2 (4g3m D:146-359)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154140Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
    Pfam PF01872
  6. 2154144Protein Riboflavin biosynthesis protein RibD [142702] (2 species)
  7. 2154145Species Bacillus subtilis [TaxId:1423] [142703] (4 PDB entries)
    Uniprot P17618 146-359
  8. 2154153Domain d4g3md2: 4g3m D:146-359 [221688]
    Other proteins in same PDB: d4g3ma1, d4g3ma3, d4g3mb1, d4g3mb3, d4g3mc1, d4g3mc3, d4g3md1, d4g3md3
    automated match to d2b3za1
    complexed with ai9, aof, zn

Details for d4g3md2

PDB Entry: 4g3m (more details), 2.56 Å

PDB Description: Complex Structure of Bacillus subtilis RibG: The Deamination Process in Riboflavin Biosynthesis
PDB Compounds: (D:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d4g3md2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g3md2 c.71.1.2 (D:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
pyvtlkaaasldgkiatstgdskwitseaarqdaqqyrkthqsilvgvgtvkadnpsltc
rlpnvtkqpvrvildtvlsipedakvicdqiaptwifttaradeekkkrlsafgvniftl
eteriqipdvlkilaeegimsvyveggsavhgsfvkegcfqeiifyfapkliggthapsl
isgegfqsmkdvpllqftditqigrdikltakpt

SCOPe Domain Coordinates for d4g3md2:

Click to download the PDB-style file with coordinates for d4g3md2.
(The format of our PDB-style files is described here.)

Timeline for d4g3md2: