| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) ![]() contains extra C-terminal strand 5, order 21345 |
| Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
| Protein Riboflavin biosynthesis protein RibD [142837] (2 species) |
| Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries) Uniprot P17618 1-145 |
| Domain d4g3mc1: 4g3m C:-1-145 [221685] Other proteins in same PDB: d4g3ma2, d4g3mb2, d4g3mc2, d4g3md2 automated match to d2b3za2 complexed with ai9, aof, zn |
PDB Entry: 4g3m (more details), 2.56 Å
SCOPe Domain Sequences for d4g3mc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g3mc1 c.97.1.2 (C:-1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
gsmeeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihma
gahaegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeag
ievregiladqaerlnekflhfmrtgl
Timeline for d4g3mc1: