Lineage for d4g3mb1 (4g3m B:1-145)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166092Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2166093Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2166168Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2166219Protein Riboflavin biosynthesis protein RibD [142837] (2 species)
  7. 2166220Species Bacillus subtilis [TaxId:1423] [142838] (4 PDB entries)
    Uniprot P17618 1-145
  8. 2166226Domain d4g3mb1: 4g3m B:1-145 [221683]
    Other proteins in same PDB: d4g3ma2, d4g3ma3, d4g3mb2, d4g3mb3, d4g3mc2, d4g3mc3, d4g3md2, d4g3md3
    automated match to d2b3za2
    complexed with ai9, aof, zn

Details for d4g3mb1

PDB Entry: 4g3m (more details), 2.56 Å

PDB Description: Complex Structure of Bacillus subtilis RibG: The Deamination Process in Riboflavin Biosynthesis
PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d4g3mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g3mb1 c.97.1.2 (B:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]}
meeyymklaldlakqgegqtesnplvgavvvkdgqivgmgahlkygeahaevhaihmaga
haegadiyvtlepcshygktppcaeliinsgikrvfvamrdpnplvagrgismmkeagie
vregiladqaerlnekflhfmrtgl

SCOPe Domain Coordinates for d4g3mb1:

Click to download the PDB-style file with coordinates for d4g3mb1.
(The format of our PDB-style files is described here.)

Timeline for d4g3mb1: