SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4g3jd_ (4g3j D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (57 species)
    not a true protein
  7. 2006000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (7 PDB entries)
  8. 2006016Domain d4g3jd_: 4g3j D: [221680]
    automated match to d3khma_
    complexed with hem, vnt

Details for d4g3jd_

PDB Entry: 4g3j (more details), 1.83 Å

PDB Description: sterol 14-alpha demethylase (cyp51) from trypanosoma brucei in complex with the vni derivative (r)-n-(1-(2,4-dichlorophenyl)-2-(1h-1,2,4- triazol-1-yl)ethyl)-4-(5-phenyl-1,3,4-oxadiazol-2-yl)benzamide [r- vni-triazole (vnt)]
PDB Compounds: (D:) Sterol 14-alpha-demethylase

SCOPe Domain Sequences for d4g3jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g3jd_ a.104.1.0 (D:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsr
fflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessl
ipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgllsa
vyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpa
qlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllsh
hdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqll
rdevpdpdyhtmvvgptasqcrvkyirr

SCOPe Domain Coordinates for d4g3jd_:

Click to download the PDB-style file with coordinates for d4g3jd_.
(The format of our PDB-style files is described here.)

Timeline for d4g3jd_: