Lineage for d4g3jd_ (4g3j D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (54 species)
    not a true protein
  7. 2006000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (7 PDB entries)
  8. 2006016Domain d4g3jd_: 4g3j D: [221680]
    automated match to d3khma_
    complexed with hem, vnt

Details for d4g3jd_

PDB Entry: 4g3j (more details), 1.83 Å

PDB Description: sterol 14-alpha demethylase (cyp51) from trypanosoma brucei in complex with the vni derivative (r)-n-(1-(2,4-dichlorophenyl)-2-(1h-1,2,4- triazol-1-yl)ethyl)-4-(5-phenyl-1,3,4-oxadiazol-2-yl)benzamide [r- vni-triazole (vnt)]
PDB Compounds: (D:) Sterol 14-alpha-demethylase

SCOPe Domain Sequences for d4g3jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g3jd_ a.104.1.0 (D:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsr
fflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
evrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessl
ipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgllsa
vyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpa
qlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllsh
hdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqll
rdevpdpdyhtmvvgptasqcrvkyirr

SCOPe Domain Coordinates for d4g3jd_:

Click to download the PDB-style file with coordinates for d4g3jd_.
(The format of our PDB-style files is described here.)

Timeline for d4g3jd_: